Gastrin Releasing Peptide, human

Gastrin Releasing Peptide, human is a neuropeptide implicated in regulatory signaling across digestive pathways. Its sequence supports exploration of receptor selectivity and molecular recognition. Researchers employ it to examine structural features that govern ligand–receptor communication. The peptide is widely used in neuroendocrine and metabolic biochemical studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G03016

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C130H204N38O31S2
M.W/Mr.
2859.3
Sequence
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Length
27

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisPeptide CDMOPeptide Analysis ServicesCustom Conjugation ServicecGMP Peptide ServiceEpitope Mapping ServicesPeptide Modification ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers