Home > Product > Catalog Peptides > Others > Gastrin Releasing Peptide, human

Others

Gastrin Releasing Peptide, human

Price Inquiry
CAT#
G03016
Sequence
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
M.W/Mr.
2859.3
Molecular Formula
C130H204N38O31S2
Length
27

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.