GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1.
Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
M.F/Formula | C₁₄₉H₂₂₁N₃₇O₄₉ |
M.W/Mr. | 3314.62 |
Sequence | One Letter Code: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG three Letter Code: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.