GLP-1 moiety from Dulaglutide

GLP-1 moiety from Dulaglutide is a 31-amino acid fragment of Dulaglutide which is a glucagon-like peptide 1 receptor (GLP-1) agonist, extracted from patent US 20160369010 A1.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1380

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₄₉H₂₂₁N₃₇O₄₉
M.W/Mr.
3314.62
Sequence
One Letter Code: HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG
three Letter Code: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly

GLP-1 moiety from Dulaglutide is a synthetic peptide fragment that mirrors the glucagon-like peptide-1 (GLP-1) domain present in the therapeutic fusion protein dulaglutide. As a bioactive segment, it retains the essential GLP-1 receptor agonist properties while being structurally distinct from the full-length protein conjugate. This moiety is of significant research interest due to its role in modulating glucose metabolism, insulin secretion, and cellular signaling pathways relevant to metabolic studies. Its availability as an isolated peptide enables detailed investigation into the fundamental mechanisms of GLP-1 receptor activation, peptide-receptor interactions, and downstream signaling events, independent of the larger dulaglutide construct.

Peptide receptor pharmacology: The GLP-1 moiety serves as a valuable tool in studies of peptide-receptor interactions, particularly those involving the GLP-1 receptor (GLP-1R). Researchers use this fragment to characterize binding affinity, receptor specificity, and activation kinetics in cell-based assays, facilitating the dissection of molecular determinants that govern receptor engagement. By isolating the active domain from the full therapeutic, it is possible to study structure-activity relationships and the contribution of specific amino acid residues to receptor activation, which is crucial for rational design of next-generation GLP-1 analogs.

Signal transduction analysis: Utilization of the GLP-1 moiety enables precise examination of intracellular signaling cascades triggered by GLP-1R agonism. In vitro systems employing this peptide allow for controlled assessment of downstream pathways such as cyclic AMP (cAMP) production, protein kinase A (PKA) activation, and other secondary messenger responses. These studies are essential for elucidating the cellular consequences of GLP-1R stimulation and for comparing the signaling profiles of modified versus native peptide sequences.

Metabolic research: The isolated GLP-1 fragment is frequently employed in metabolic studies to probe its effects on glucose-stimulated insulin secretion and pancreatic β-cell function. Experimental models utilizing this peptide facilitate the investigation of insulinotropic mechanisms, glucose homeostasis, and the modulation of metabolic gene expression. Such research underpins the development of improved peptide-based agents targeting metabolic disorders and provides insights into the physiological relevance of GLP-1 signaling.

Peptide engineering and optimization: Access to the GLP-1 moiety is instrumental in peptide engineering workflows, where it acts as a template for the synthesis of novel analogs with enhanced stability, bioactivity, or receptor selectivity. Researchers can introduce targeted modifications, such as amino acid substitutions or backbone alterations, to systematically study the impact on function and pharmacological properties. This approach accelerates the optimization of peptide therapeutics and supports the advancement of innovative drug candidates.

Analytical method development: The GLP-1 moiety is utilized as a reference standard or calibration material in the development and validation of analytical assays, including liquid chromatography-mass spectrometry (LC-MS) and immunoassays. Its defined structure and bioactivity make it suitable for quantifying peptide content, assessing degradation products, and monitoring peptide integrity in various research and quality control settings. These analytical applications are critical for ensuring consistency and reliability in peptide-based research and development workflows.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicescGMP Peptide ServicePeptide CDMOPeptide Analysis ServicesCustom Conjugation ServicePeptide Modification ServicesPeptide Synthesis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers