Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | VQETQKLAKTVGANLEETNKKLAPQIKSAYDDFVKQAQEVQKKLHEAASKQ |
Activity | Gram+, |
Host Chemicals | wax moth, Galleria mellonella |
Length | 51 |
1. Cationic cell-penetrating peptides are potent furin inhibitors
3. Immune-awakening Saccharomyces-inspired nanocarrier for oral target delivery to lymph and tumors
5. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.