CAT# | G09009 |
M.F/Formula | C215H357N71O67S |
M.W/Mr. | 5040.70 |
Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
Length | 44 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G09004 | Growth Hormone Pro-Releasing Factor, human | Inquiry | ||
G09006 | GRF (1-40), human | Inquiry | ||
G09005 | Growth Hormone Releasing Factor, GRF (1 - 40), amide, human | Inquiry | ||
G09017 | (Nle27)-GRF (1-29) amide (human) | Inquiry | ||
G09010 | GRF (porcine) | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
PR 39, a porcine 39-aa peptide antibiotic, was originally isolated from the upper part of the small intestine o ...
TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...
ICI 174,864 is an opioid peptide, belonging to subclasses of opioid receptors. Its chemical structure is N, N-di ...