GRF (free acid) (human)

GRF (free acid) (human) is a full-length releasing factor in its non-amidated form, used to investigate helix propensity and C-terminal flexibility. Its sequence supports mapping of functional domains. Researchers assess conformation to explore receptor-binding surfaces. The molecule contributes to neuroendocrine peptide research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: G09009

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C215H357N71O67S
M.W/Mr.
5040.70
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Length
44

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Synthesis ServicesPeptide CDMOPeptide Modification ServicesEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Analysis ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers