GRP78 Binding Chimeric Peptide Motif

GRP78 Binding Chimeric Peptide Motif is engineered to examine interactions with the GRP78 chaperone domain. Its mixed sequence supports mapping of hydrophobic anchoring and charged-residue alignment. Researchers assess conformational preference for binding-site modeling. The molecule contributes to unfolded-protein response studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: A23047

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
2721.5
Sequence
WIFPWIQLGGDKDLDADKDLDADKDKDLDADKDLDADK-NH2
Length
38

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesPeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide CDMOcGMP Peptide ServiceEpitope Mapping ServicesCustom Conjugation ServicePeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers