Guangxitoxin-1E is a specific inhibitor of the Kv current of β-cells, can enhance the glucose-dependent intracellular calcium elevations and increases the glucose-dependent insulin secretion. It is considered as a useful tool for the investigation of type 2 diabetes.
CAT# | R0935 |
CAS | 1233152-82-3 |
Background | Guangxitoxin-1E (GxTX-1E) is a strong inhibitor of the Kv current of β-cells. GxTX-1E enhances the glucose-dependent intracellular calcium elevations and increases the glucose-dependent insulin secretion. It is suspected that Guangxitoxin-1E blocks of Kv2.1 channel and may be a useful tool for the investigation of type 2 diabetes. >> Read More |
M.F/Formula | C178H248N44O45S7 |
M.W/Mr. | 3948.61 |
Sequence | EGECGGFWWKCGSGKPACCPKYVCSPKWGLCNFPMP(Modifications: Disulfide bridge: 4-19,11-24,18-31) |
Labeling Target | Kv2.1 / Kv2.2 channel |
Appearance | White lyophilized solid |
Purity | >98% |
Activity | Inhibitor |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...
Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...