Home > Product > Antimicrobial Peptides > Heliomicin Mutant

Antimicrobial Peptides

Heliomicin Mutant

Price Inquiry
CAT#
AF3065
Sequence
DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET
Host Chemicals
Heliothis virescens
Length
44
Activity
Antibacterial, Antifungal
SwissProt ID
P81544

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.