Keywords Search Google Search Search

Hemopexin-like 2

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	M13013
Sequence	IDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPP

CAT#	Product Name	Inquiry
X01697	PH1PO085_08	Inquiry
X19497	UP_P80819	Inquiry
X07826	PM_16316187	Inquiry
X14937	PM_8554547	Inquiry
C08124	KM-HN-1(335-343)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

A novel antiarrhythmic peptide–rotigaptide

Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...

Function of dynorphin (1-17) in analgesia

In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...

GaTx2, a Peptide Inhibitor of ClC-2 Chloride Channels

ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...

The mechanism and function of acetyl tetrapeptide-2 in human skin

Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...

The Function of Deferasirox in Iron Overload

Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: