Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD |
Activity | Antibacterial, Antifungal |
Host Chemicals | Homo sapiens |
Length | 43 |
1. The spatiotemporal control of signalling and trafficking of the GLP-1R
2. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.