CAT# | I04002 |
M.F/Formula | C219H349N69O66S3 |
M.W/Mr. | 5100.80 |
Sequence | TQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSY-NH2 |
Length | 47 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
I04004 | Intermedin (human) trifluoroacetate salt | Inquiry | ||
I04005 | Intermedin (rat) trifluoroacetate salt | Inquiry | ||
I04003 | Biotinyl-Intermedin (rat) | Inquiry | ||
I04001 | Intermedin (rat) | Inquiry | ||
I04006 | Intermedin-53 (human) trifluoroacetate salt | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...