Jingzhaotoxin-XII

Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Peptide Library Construction and Screening

Powerful screening tools in biological and chemical research

M.F/FormulaC161H227N41O44S7
M.W/Mr.3665.23
SequenceOne Letter Code:YCQKWMWTCDSERKCCEGYVCELWCKYNL-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25)
Three Letter Code:Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Tyr-Val-Cys-Glu-Leu-Trp-Cys-Lys-Tyr-Asn-Leu-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25)
Write a review Ask a question
My Review for Jingzhaotoxin-XII

Required fields are marked with *

  • Basic Information
×
Ask a Question for Jingzhaotoxin-XII

Required fields are marked with *

  • Basic Information
×
Featured Recommendations
Related Screening Libraries:
Related Small Molecules:
Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.

Featured Services
Hot Products
  • Angiotensin II Acetate

    Angiotensin II is an octapeptide that produced from angiotensin I after the removal of two amino acids at the C-terminal by angiotensin-converting enzyme (ACE). Angiotensin II is mediated by AT1 and AT2 receptors, which are seven transmembrane glycoproteins with 30% sequence similarity.

    Inquiry
  • Icatibant

    Icatibant (Firazyr) is a synthetic peptidomimetic drug consisting of ten amino acids, and acts as an effective and specific antagonist of bradykinin B2 receptors. It has been approved in the EU for use in hereditary angioedema, and is under investigation for a number of other conditions in which bradykinin is thought to play a significant role.

    Inquiry
  • Teduglutide

    Teduglutide is a polypeptide consisting of 33 amino acids. It is glucagon-like peptide-2 (GLP-2) analogue that is used for the treatment of short bowel syndrome.

    Inquiry
  • Aviptadil Acetate

    Aviptadil, also known as vasoactive intestinal polypeptide (VIP), is a 28 amino acid neuropeptide that belongs to the glucagon-growth hormone-releasing factor secretion superfamily. Aviptadil acts as a potent systemic vasodilator and bronchodilator. It inhibits the proliferation of vascular and bronchial smooth muscle cells and decreases platelet aggregation. These biological effects are mediated by specific VIP receptors.

    Inquiry
  • Lanreotide Acetate

    Lanreotide is a a synthetic cyclic octapeptide analogue of somatostatin. Lanreotide inhibits the secretion of growth hormone (GH) by binding to pituitary somatostatin receptors, and may inhibit the release of various other hormones, including thyroid stimulating hormone (TSH) and the gastroenteropancreatic hormones insulin, glucagon and gastrin.

    Inquiry
  • Glucagon

    Glucagon (Porcine glucagon) is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis. Glucagon decreases the activity of HNF-4. Glucagon increases HNF4α phosphorylation.

    Inquiry
  • Alarelin acetate

    Alarelin acetate is a synthetic LH-RH agonist, and stimulates the release of FSH and LH from the pituitary gland. It is known for its induction of ovulation and used to treat endmometriosis.

    Inquiry
  • Deslorelin Acetate

    Deslorelin acetate is an injectable gonadotropin releasing hormone super-agonist (GnRH agonist) also known as an LHRH agonist. It stops the production of sex hormones (testosterone and oestrogen).

    Inquiry
  • Somatostatin

    Somatostatin is a tetradecapeptide which can suppress the growth hormone (GH) secretion and control the pituitary hormone secretion in human CNS.

    Inquiry
Get in touch with us

USA

Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA

Tel: 1-631-624-4882

Fax: 1-631-614-7828

Email: info@creative-peptides.com

 

Germany

Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main

Email: info@creative-peptides.com

Copyright © 2025 Creative Peptides. All rights reserved.