Jingzhaotoxin-XII

Jingzhaotoxin-XII is a spider-venom peptide stabilized by multiple disulfide bridges, producing a compact, highly folded scaffold. Residues are arranged to recognize specific ion channels with high affinity. Researchers use electrophysiological assays and structural methods to define channel-binding epitopes. Applications include toxin-motif engineering, ion-channel pharmacology, and disulfide-rich peptide design.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2868

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C161H227N41O44S7
M.W/Mr.
3665.23
Sequence
One Letter Code:YCQKWMWTCDSERKCCEGYVCELWCKYNL-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25)
Three Letter Code:Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Tyr-Val-Cys-Glu-Leu-Trp-Cys-Lys-Tyr-Asn-Leu-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Synthesis ServicescGMP Peptide ServicePeptide CDMOCustom Conjugation ServicePeptide Modification ServicesEpitope Mapping ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers