Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C149H226N42O39 |
M.W/Mr. | 3229.69 |
Sequence | IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 |
Length | 28 |
1. Emu oil in combination with other active ingredients for treating skin imperfections
2. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.