Kisspeptins

Kisspeptins represent a peptide family containing conserved aromatic, basic, and polar residues that shape receptor-interaction behavior. Their modular structures facilitate investigations of conformational dynamics and proteolytic processing. Researchers explore their behavior to understand motif-driven binding patterns. Applications include peptide design, structural mapping, and biochemical signaling studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Kisspeptins(CAS 388138-21-4)

CAT No: R2438

CAS No:388138-21-4

Synonyms/Alias:Kisspeptin;Protein KISS-1;Kisspeptins;Gene KISS1 protein;KISS-1;Metastin;388138-21-4;KISS-1 metastasis suppressor;2VG74ZW2K5;KISS-1 (68-121);UNII-2VG74ZW2K5;DTXSID00192075;Malignant melanoma metastasis-suppressor protein, human;Kisspeptin (zebrafish);Metastins;Kisspeptin-1;kisspeptin-54;DTXCID10114566;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C258H401N79O78
M.W/Mr.
5857
Sequence
One Letter Code:GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF
Three Letter Code:H-Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2

Kisspeptins are a family of peptide hormones that play a pivotal role in the regulation of the reproductive axis and neuroendocrine signaling. Originating from the KISS1 gene, these peptides are recognized for their ability to modulate the release of gonadotropin-releasing hormone (GnRH), thereby influencing the hypothalamic-pituitary-gonadal (HPG) axis. Their discovery has significantly advanced understanding of puberty onset, fertility mechanisms, and broader neuroendocrine interactions. In addition to their central role in reproductive biology, kisspeptins are increasingly studied for their involvement in cell signaling, migration, and tumor metastasis suppression, making them a focal point for a wide range of biochemical and physiological research.

Endocrine research: Kisspeptin peptides are extensively utilized in studies aiming to elucidate the molecular mechanisms governing reproductive hormone regulation. By acting directly on GnRH neurons, these peptides serve as essential tools for investigating the upstream control of gonadotropin secretion. Researchers employ synthetic and native forms of the peptides to dissect the signaling pathways and feedback loops that underpin puberty initiation, sexual maturation, and fertility. Their use in experimental models has provided critical insight into the neuroendocrine integration of metabolic and environmental cues affecting reproductive health.

Neurobiology: The role of kisspeptins in central nervous system signaling extends beyond reproductive control, positioning them as valuable reagents for neurobiological investigations. Scientists utilize these peptides to probe neural circuits involved in behavior, stress response, and neuroendocrine communication. Their ability to activate specific G-protein coupled receptors (GPR54/KISS1R) facilitates targeted studies of neuronal excitability, synaptic transmission, and neuropeptide interactions. Such research supports the broader understanding of brain function and the interplay between hormonal and neural networks.

Cancer metastasis research: Kisspeptins are recognized for their function as metastasis suppressors, particularly in the context of melanoma and other malignancies. Laboratory studies leverage these peptides to explore their inhibitory effects on tumor cell migration and invasion, providing mechanistic insights into the molecular barriers that prevent metastatic spread. By modulating cell adhesion molecules and signaling cascades, kisspeptins enable the dissection of anti-metastatic pathways, offering valuable data for the development of novel anti-cancer strategies in preclinical settings.

Peptide receptor pharmacology: The specificity of kisspeptin peptides for the KISS1R receptor makes them indispensable tools in receptor-ligand binding studies and pharmacological profiling. Researchers employ these molecules to characterize receptor activation, desensitization, and downstream signaling events. Such applications are fundamental for the development of receptor agonists, antagonists, and allosteric modulators, supporting both basic research and early-stage drug discovery efforts focused on G-protein coupled receptor (GPCR) biology.

Peptide synthesis and analytical validation: Synthetic kisspeptin fragments and analogs are widely used in the optimization of peptide synthesis protocols and analytical method development. Their defined sequence and biological activity facilitate the calibration of chromatographic and mass spectrometric techniques, ensuring accurate quantification and structural confirmation. These peptides serve as reference standards and positive controls in quality assurance processes, supporting the reliability and reproducibility of peptide-based research and development workflows.

InChI
InChI=1S/C258H401N79O78/c1-21-131(16)204(329-220(381)152(70-77-189(264)351)301-213(374)147(53-34-84-281-257(274)275)299-234(395)173(118-341)322-226(387)164(103-140-110-278-123-288-140)315-242(403)181-58-38-87-331(181)247(408)133(18)290-232(393)172(117-340)321-222(383)158(95-125(4)5)293-197(359)114-287-238(399)178-55-36-88-332(178)249(410)155(71-78-190(265)352)306-218(379)150(68-75-187(262)349)300-212(373)146(52-33-83-280-256(272)273)298-233(394)171(116-339)294-198(360)113-286-210(371)170(115-338)319-237(398)175(120-343)320-219(380)154(73-80-200(363)364)304-241(402)183-60-40-90-334(183)252(413)185-62-43-93-337(185)253(414)184-61-42-92-336(184)251(412)177(122-345)325-223(384)159(96-126(6)7)308-236(397)176(121-344)324-246(407)205(135(20)346)326-194(356)108-260)254(415)335-91-41-56-179(335)239(400)291-134(19)248(409)330-86-37-57-180(330)240(401)303-149(67-74-186(261)348)208(369)284-111-195(357)289-132(17)207(368)327-202(129(12)13)245(406)317-160(97-127(8)9)231(392)328-203(130(14)15)244(405)305-151(69-76-188(263)350)216(377)296-145(51-32-82-279-255(270)271)211(372)302-153(72-79-199(361)362)217(378)295-144(50-30-31-81-259)215(376)314-168(107-201(365)366)230(391)318-169(98-128(10)11)250(411)333-89-39-59-182(333)243(404)316-167(106-193(268)355)228(389)310-162(101-138-63-65-141(347)66-64-138)224(385)312-165(104-191(266)353)227(388)311-163(102-139-109-283-143-49-29-28-48-142(139)143)225(386)313-166(105-192(267)354)229(390)323-174(119-342)235(396)309-161(100-137-46-26-23-27-47-137)209(370)285-112-196(358)292-157(94-124(2)3)221(382)297-148(54-35-85-282-258(276)277)214(375)307-156(206(269)367)99-136-44-24-22-25-45-136/h22-29,44-49,63-66,109-110,123-135,144-185,202-205,283,338-347H,21,30-43,50-62,67-108,111-122,259-260H2,1-20H3,(H2,261,348)(H2,262,349)(H2,263,350)(H2,264,351)(H2,265,352)(H2,266,353)(H2,267,354)(H2,268,355)(H2,269,367)(H,278,288)(H,284,369)(H,285,370)(H,286,371)(H,287,399)(H,289,357)(H,290,393)(H,291,400)(H,292,358)(H,293,359)(H,294,360)(H,295,378)(H,296,377)(H,297,382)(H,298,394)(H,299,395)(H,300,373)(H,301,374)(H,302,372)(H,303,401)(H,304,402)(H,305,405)(H,306,379)(H,307,375)(H,308,397)(H,309,396)(H,310,389)(H,311,388)(H,312,385)(H,313,386)(H,314,376)(H,315,403)(H,316,404)(H,317,406)(H,318,391)(H,319,398)(H,320,380)(H,321,383)(H,322,387)(H,323,390)(H,324,407)(H,325,384)(H,326,356)(H,327,368)(H,328,392)(H,329,381)(H,361,362)(H,363,364)(H,365,366)(H4,270,271,279)(H4,272,273,280)(H4,274,275,281)(H4,276,277,282)/t131-,132-,133-,134-,135+,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,166-,167-,168-,169-,170-,171-,172-,173-,174-,175-,176-,177-,178-,179-,180-,181-,182-,183-,184-,185-,202-,203-,204-,205-/m0/s1
InChI Key
KAHDONZOCXSKII-NJVVDGNHSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicesCustom Conjugation ServicePeptide Analysis ServicesPeptide Nucleic Acids SynthesiscGMP Peptide ServicePeptide CDMOEpitope Mapping ServicesPeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers