Kisspeptins

Kisspeptins represent a peptide family containing conserved aromatic, basic, and polar residues that shape receptor-interaction behavior. Their modular structures facilitate investigations of conformational dynamics and proteolytic processing. Researchers explore their behavior to understand motif-driven binding patterns. Applications include peptide design, structural mapping, and biochemical signaling studies.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.
Kisspeptins(CAS 388138-21-4)

CAT No: R2438

CAS No:388138-21-4

Synonyms/Alias:Kisspeptin;Protein KISS-1;Kisspeptins;Gene KISS1 protein;KISS-1;Metastin;388138-21-4;KISS-1 metastasis suppressor;2VG74ZW2K5;KISS-1 (68-121);UNII-2VG74ZW2K5;DTXSID00192075;Malignant melanoma metastasis-suppressor protein, human;Kisspeptin (zebrafish);Metastins;Kisspeptin-1;kisspeptin-54;DTXCID10114566;

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C258H401N79O78
M.W/Mr.
5857
Sequence
One Letter Code:GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF
Three Letter Code:H-Gly-Thr-Ser-Leu-Ser-Pro-Pro-Pro-Glu-Ser-Ser-Gly-Ser-Arg-Gln-Gln-Pro-Gly-Leu-Ser-Ala-Pro-His-Ser-Arg-Gln-Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2

Kisspeptins, also known as metastin peptides, represent a family of neuropeptides that have garnered significant attention in the scientific community due to their pivotal regulatory roles in various physiological processes. These peptides are encoded by the KISS1 gene and are widely recognized for their ability to modulate the hypothalamic-pituitary-gonadal (HPG) axis, making them a central focus in studies of endocrine signaling and reproductive biology. Kisspeptins are characterized by their highly conserved C-terminal region, which is essential for receptor binding and biological activity. Their interaction with the G-protein coupled receptor GPR54 (also known as KISS1R) underpins a variety of downstream effects, influencing not only reproductive function but also energy balance, tumor metastasis, and neuroendocrine integration. The versatility and specificity of kisspeptin signaling, coupled with its broad tissue distribution, have made these peptides invaluable in research settings seeking to unravel complex hormonal networks and intercellular communication mechanisms.

Reproductive Endocrinology: Within the field of reproductive biology, kisspeptins are extensively employed to investigate the mechanisms underlying puberty onset, gonadotropin-releasing hormone (GnRH) secretion, and fertility regulation. By acting directly on GnRH neurons in the hypothalamus, these peptides serve as critical upstream modulators, initiating the cascade of hormonal events that govern sexual maturation and reproductive cyclicity. Researchers utilize kisspeptin analogs and antagonists to dissect the temporal and spatial dynamics of GnRH release, facilitating the development of experimental models that elucidate the genetic and environmental factors influencing reproductive health.

Cancer Metastasis Research: In oncology, metastin peptides have been instrumental in exploring the molecular pathways that suppress tumor metastasis. Originally identified for their role in inhibiting the spread of malignant cells, these peptides are studied for their ability to modulate cell adhesion, migration, and invasion. Through in vitro and in vivo models, scientists leverage kisspeptin signaling to delineate the interactions between tumor cells and the extracellular matrix, shedding light on the molecular checkpoints that prevent secondary tumor formation. This research not only enhances the understanding of cancer progression but also aids in identifying potential molecular targets for therapeutic intervention.

Neuroendocrine Regulation: Kisspeptins serve as a valuable tool in the study of neuroendocrine integration, particularly regarding the crosstalk between metabolic status and reproductive function. The peptides' expression is sensitive to nutritional cues and energy availability, making them a focal point in research on hypothalamic sensing mechanisms. By manipulating kisspeptin pathways, investigators can examine how metabolic disorders, such as obesity or undernutrition, impact reproductive hormone secretion and overall endocrine balance. This line of inquiry has expanded the understanding of how environmental and physiological stressors interface with neuroendocrine circuits.

Behavioral Neuroscience: In the realm of behavioral science, these neuropeptides are utilized to probe the neural substrates of sexual behavior, social interaction, and stress responses. Experimental administration of kisspeptin analogs in animal models allows researchers to map the neural circuits involved in reproductive and affiliative behaviors, as well as to assess the influence of hormonal fluctuations on mood and cognition. The ability of kisspeptins to cross the blood-brain barrier and directly influence central nervous system activity positions them as a unique tool for dissecting the neurobiological basis of behavior.

Comparative Endocrinology: The evolutionary conservation of kisspeptin signaling across vertebrate species has made it a subject of comparative studies aimed at understanding the diversification of reproductive strategies. Researchers employ kisspeptin assays in a variety of animal models, from fish to mammals, to investigate how differences in peptide structure and receptor distribution contribute to species-specific patterns of reproductive timing and development. These comparative analyses provide insights into the adaptive significance of kisspeptin pathways and their role in the evolution of endocrine regulation. Through these diverse research applications, kisspeptins continue to advance scientific knowledge across multiple disciplines, offering a versatile platform for probing the intricate interplay between hormones, behavior, and physiology.

InChI
InChI=1S/C258H401N79O78/c1-21-131(16)204(329-220(381)152(70-77-189(264)351)301-213(374)147(53-34-84-281-257(274)275)299-234(395)173(118-341)322-226(387)164(103-140-110-278-123-288-140)315-242(403)181-58-38-87-331(181)247(408)133(18)290-232(393)172(117-340)321-222(383)158(95-125(4)5)293-197(359)114-287-238(399)178-55-36-88-332(178)249(410)155(71-78-190(265)352)306-218(379)150(68-75-187(262)349)300-212(373)146(52-33-83-280-256(272)273)298-233(394)171(116-339)294-198(360)113-286-210(371)170(115-338)319-237(398)175(120-343)320-219(380)154(73-80-200(363)364)304-241(402)183-60-40-90-334(183)252(413)185-62-43-93-337(185)253(414)184-61-42-92-336(184)251(412)177(122-345)325-223(384)159(96-126(6)7)308-236(397)176(121-344)324-246(407)205(135(20)346)326-194(356)108-260)254(415)335-91-41-56-179(335)239(400)291-134(19)248(409)330-86-37-57-180(330)240(401)303-149(67-74-186(261)348)208(369)284-111-195(357)289-132(17)207(368)327-202(129(12)13)245(406)317-160(97-127(8)9)231(392)328-203(130(14)15)244(405)305-151(69-76-188(263)350)216(377)296-145(51-32-82-279-255(270)271)211(372)302-153(72-79-199(361)362)217(378)295-144(50-30-31-81-259)215(376)314-168(107-201(365)366)230(391)318-169(98-128(10)11)250(411)333-89-39-59-182(333)243(404)316-167(106-193(268)355)228(389)310-162(101-138-63-65-141(347)66-64-138)224(385)312-165(104-191(266)353)227(388)311-163(102-139-109-283-143-49-29-28-48-142(139)143)225(386)313-166(105-192(267)354)229(390)323-174(119-342)235(396)309-161(100-137-46-26-23-27-47-137)209(370)285-112-196(358)292-157(94-124(2)3)221(382)297-148(54-35-85-282-258(276)277)214(375)307-156(206(269)367)99-136-44-24-22-25-45-136/h22-29,44-49,63-66,109-110,123-135,144-185,202-205,283,338-347H,21,30-43,50-62,67-108,111-122,259-260H2,1-20H3,(H2,261,348)(H2,262,349)(H2,263,350)(H2,264,351)(H2,265,352)(H2,266,353)(H2,267,354)(H2,268,355)(H2,269,367)(H,278,288)(H,284,369)(H,285,370)(H,286,371)(H,287,399)(H,289,357)(H,290,393)(H,291,400)(H,292,358)(H,293,359)(H,294,360)(H,295,378)(H,296,377)(H,297,382)(H,298,394)(H,299,395)(H,300,373)(H,301,374)(H,302,372)(H,303,401)(H,304,402)(H,305,405)(H,306,379)(H,307,375)(H,308,397)(H,309,396)(H,310,389)(H,311,388)(H,312,385)(H,313,386)(H,314,376)(H,315,403)(H,316,404)(H,317,406)(H,318,391)(H,319,398)(H,320,380)(H,321,383)(H,322,387)(H,323,390)(H,324,407)(H,325,384)(H,326,356)(H,327,368)(H,328,392)(H,329,381)(H,361,362)(H,363,364)(H,365,366)(H4,270,271,279)(H4,272,273,280)(H4,274,275,281)(H4,276,277,282)/t131-,132-,133-,134-,135+,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,159-,160-,161-,162-,163-,164-,165-,166-,167-,168-,169-,170-,171-,172-,173-,174-,175-,176-,177-,178-,179-,180-,181-,182-,183-,184-,185-,202-,203-,204-,205-/m0/s1
InChI Key
KAHDONZOCXSKII-NJVVDGNHSA-N

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Synthesis ServicesCustom Conjugation ServiceEpitope Mapping ServicesPeptide CDMOPeptide Analysis ServicesPeptide Nucleic Acids SynthesisPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers