KP1

KP1 is a designed peptide motif with selected hydrophobic, polar, and basic residues arranged to study binding interfaces and conformational adaptability. Researchers examine its folding landscape using spectroscopic methods. The sequence provides modular features for ligand-receptor modeling. Applications include peptide-engineering research, structural studies, and sequence-activity analysis.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2778

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C149H203N39O43
M.W/Mr.
3228.44
Sequence
One Letter Code:FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG
Three Letter Code:Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly

KP1 is a synthetic peptide compound widely recognized for its utility in molecular biology and biochemical research. As a short, defined-sequence peptide, KP1 is designed to mimic or modulate specific protein interactions, making it a valuable tool for probing signaling pathways, investigating receptor-ligand dynamics, and studying post-translational modifications. Its well-characterized structure and predictable biochemical behavior provide researchers with a consistent and reliable reagent for a variety of experimental applications. The relevance of KP1 extends across multiple research fields, including cell signaling, peptide-receptor studies, and the development of peptide-based assays, reflecting its functional significance in both fundamental and applied biosciences.

Peptide signaling studies: KP1 is frequently employed as a molecular probe to investigate peptide-mediated signaling pathways. Its defined sequence enables researchers to dissect the interactions between peptides and their cognate receptors, facilitating the exploration of downstream cellular responses. By introducing KP1 into cell-based or in vitro systems, scientists can monitor activation or inhibition of specific signaling cascades, thereby elucidating the functional roles of peptide ligands in physiological and pathophysiological contexts.

Receptor binding assays: The compound serves as a model ligand in receptor binding studies, allowing for quantitative and qualitative assessment of peptide-receptor affinities. Utilizing radiolabeled or fluorescently tagged versions of KP1, researchers can perform competitive binding experiments to determine receptor specificity, binding kinetics, and the effects of structural modifications on ligand recognition. These assays are crucial for characterizing new receptor subtypes and screening for potential modulators in drug discovery pipelines.

Peptide structure-function analysis: KP1 is an effective tool in structure-activity relationship (SAR) investigations, where systematic alterations to peptide sequence or conformation are correlated with biological activity. By employing this peptide in mutagenesis or analog synthesis studies, scientists can map critical residues responsible for bioactivity, inform rational design of improved analogs, and gain insight into the molecular determinants of protein-peptide interactions.

Peptide synthesis validation: In peptide chemistry laboratories, KP1 is often utilized as a standard for validating synthetic methodologies and analytical protocols. Its known sequence and expected chromatographic properties make it suitable for assessing the efficiency of solid-phase peptide synthesis, optimizing purification strategies, and calibrating mass spectrometry or HPLC systems. This application supports quality control and method development in peptide production workflows.

Cellular functional assays: Researchers integrate KP1 into a variety of cellular assays to monitor functional endpoints such as proliferation, migration, or gene expression in response to peptide stimulation. By titrating the peptide in controlled experimental setups, it is possible to generate dose-response curves, assess cellular sensitivity, and investigate the mechanisms underlying peptide-induced cellular changes. Such studies contribute to a deeper understanding of peptide function in cell biology and facilitate the development of new bioactive molecules for research use.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide CDMOcGMP Peptide ServicePeptide Analysis ServicesPeptide Modification ServicesPeptide Synthesis ServicesCustom Conjugation ServicePeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers