L-JNKI-1

L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1485

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₁₆₄H₂₈₆N₆₆O₄₀
M.W/Mr.
3822.44
Sequence
One Letter Code: DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2
three Letter Code: Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2

L-JNKI-1 is a cell-permeable peptide inhibitor that selectively targets the c-Jun N-terminal kinase (JNK) signaling pathway. As a synthetic peptide derived from the JNK-binding domain of JIP-1, it acts as a competitive antagonist, effectively blocking the interaction between JNK and its substrates. This compound has become a valuable molecular tool for researchers aiming to dissect JNK-dependent mechanisms in various cellular processes, including stress response, apoptosis, inflammation, and neuronal signaling. Its specificity and reversible mode of action make it particularly useful for transient modulation of JNK activity in both in vitro and in vivo experimental systems.

Signal transduction studies: L-JNKI-1 is widely employed in the investigation of mitogen-activated protein kinase (MAPK) pathways, with particular emphasis on the JNK branch. By selectively inhibiting JNK-substrate interactions, researchers can delineate the role of JNK signaling in cellular responses to environmental stressors, cytokines, and growth factors. This enables a more precise understanding of the upstream and downstream molecular events regulated by JNK, facilitating the mapping of complex signaling networks in diverse cell types.

Apoptosis research: The peptide is frequently used to probe the involvement of JNK in programmed cell death. As JNK activation is a well-documented mediator of apoptosis in response to oxidative stress, DNA damage, and inflammatory stimuli, the use of L-JNKI-1 allows for selective attenuation of JNK-driven apoptotic pathways. This approach is instrumental in clarifying the contribution of JNK to cell fate decisions and in distinguishing its effects from those mediated by other MAPK family members.

Neuroscience and neuroprotection studies: L-JNKI-1 has proven especially valuable in neurobiology, where JNK signaling is implicated in neuronal injury, synaptic plasticity, and neurodegenerative processes. By transiently inhibiting JNK activity, the peptide enables researchers to assess the impact of JNK modulation on neuronal survival, axonal regeneration, and the molecular basis of neuroinflammation. Such studies contribute to a deeper understanding of the cellular mechanisms underlying nervous system disorders and neuronal adaptation.

Inflammation and immune response analysis: The compound is utilized to interrogate the role of JNK in immune cell activation, cytokine production, and inflammatory signaling cascades. By blocking JNK-dependent transcriptional programs, L-JNKI-1 helps delineate the specific contributions of this kinase to the regulation of pro-inflammatory mediators and immune cell function. This application is critical for unraveling the molecular underpinnings of inflammatory diseases and for identifying potential points of intervention in immune regulation.

Peptide-based inhibitor validation: As a prototypical cell-permeable peptide inhibitor, L-JNKI-1 serves as a benchmark compound for the development and validation of novel peptide-based modulators targeting intracellular protein-protein interactions. Its use in structure-activity relationship studies and inhibitor screening assays provides insights into the design principles governing peptide inhibitor efficacy, selectivity, and cellular uptake. This knowledge supports ongoing efforts in chemical biology and drug discovery aimed at expanding the repertoire of bioactive peptides for research applications.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Synthesis ServicesPeptide Modification ServicesCustom Conjugation ServicePeptide Analysis ServicesPeptide CDMOPeptide Nucleic Acids SynthesiscGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers