L-JNKI-1 is a cell-permeable peptide inhibitor specific for JNK.
Registration of APIs CMC information required for an IND
IND and NDA support Drug master files (DMF) filing
M.F/Formula | C₁₆₄H₂₈₆N₆₆O₄₀ |
M.W/Mr. | 3822.44 |
Sequence | One Letter Code: DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG-NH2 three Letter Code: Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-NH2 |
3. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us. We will endeavor to provide highly satisfying products and services.