CAT# | AF3215 |
Sequence | AIKLVQSPNGNFAASFVLDGTKWIFKSKYYDSSKGYWVGIYEVWDRK |
Activity | Gram+ & Gram-, |
Host Chemicals | Bacillus subtilis | Length | 47 | SwissProt ID | PDB ID: 2B9K |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF2264 | Brevinin-2-OA8 | Inquiry | ||
AF1476 | Xenopsin precursor fragment | Inquiry | ||
AF1171 | Brevinin-1-RAA4 peptide precursor | Inquiry | ||
AF2066 | Cecropin P3 | Inquiry | ||
AF1757 | Ranatuerin-2SEA | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...
Overview of the kinin system Kinins are peptide hormones that are formed as part of the kinin-kallikrein system (KKS). kinin ...
The thymopentin is a small peptide consisting of 5 amino acid residues (Arg-Lys-Asp-Val-Tyr) from thymosin. It h ...
In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...