Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QVSQRRGPRMTPFWRAVGNKPVGAFCQQGLECTTKVCRRGHCT |
Activity | Antimicrobial |
Host Chemicals | Odorrana andersonii (golden crossband frog) |
Length | 43 |
SwissProt ID | E3SYM8 |
3. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
4. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.