CAT# | AF1965 |
Sequence | PDFKLPGMKYPIPATTPPFVPKRSRFPIYA |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
10Panx is a panx 1 mimetic inhibitor that easily and reversibly inhibits panx1 currents. In cells that are diffi ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...