CAT# | AF2930 |
Sequence | EADEPLWLYKGDNIERAPTTADHPILPSIIDDVKLDPNRRYA |
Activity | Antibacterial, Antifungal |
Host Chemicals | Galleria mellonella | Length | 42 | SwissProt ID | P85211 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1456 | Caerin 2.6 | Inquiry | ||
AF1237 | Gaegurin-RN1 | Inquiry | ||
AF1536 | Dermaseptin-like precursor DRP-AC-2 | Inquiry | ||
AF1421 | XPF-SE3 | Inquiry | ||
AF691 | Phylloseptin-J7 | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Jingzhaotoxin-III (β-TRTX-Cj1α) is a kind of sodium channel gating modifier which is from the tarantula Chilobra ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...
Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...