Keywords Search Google Search Search

[Leu32]-beta-Amyloid(1-36)

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13237
M.W/Mr.	4017.5
Sequence	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAILGLMV

CAT#	Product Name	Inquiry
A13246	Beta Amyloid (3-40)	Inquiry
A13016	Beta-Amyloid (29-40)	Inquiry
A13054	Beta-Amyloid (23-37)	Inquiry
A13041	Beta-Amyloid (10-19)	Inquiry
A13135	Beta-Amyloid (1-17)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of romurtide in anti-leukocyte

Muramyl dipeptide (MDP) is the smallest structural unit with immune activity in the skeleton of bacille calmette ...

Function of D15 As An Endocytosis Inhibitor

The endocytosis of AMPA receptors (AMPARs) requires the GTPase activity of dynamin. Since it is now established ...

Function of Gonadorelin Acetate in Central Precocious Puberty

Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...

Function of pramlintide in diabetes

Pramlintide is a synthetic analogue of pancreatic amyloid polypeptide. Pancreatic amyloid polypeptide is a polyp ...

The Usage of Pentapeptide-31

of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: