Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4570.2 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVLGVVIA |
Length | 42 |
1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
3. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
4. TMEM16F and dynamins control expansive plasma membrane reservoirs
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.