CAT# | A13315 |
M.W/Mr. | 4570.2 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVLGVVIA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...
Ramoplanin is a new kind of glycopeptide antibiotics, which can inhibit the biosynthesis of the cell walls of gr ...
This article will give a brief introduction about atosiban and focus on its role played in the treatment of pret ...