LL 37 (human) biotinylated

LL-37 (Human) Biotinylated couples the full-length cathelicidin with a biotin tag for high-affinity immobilization. The peptide retains its amphipathic, α-helical structure, enabling membrane and protein-binding studies. Researchers use streptavidin-based systems to capture complexes and map interaction partners. Applications include antimicrobial-peptide mechanism analysis, pull-down assays, and biosensor development.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2745

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C221H366N64O55S
M.W/Mr.
4832.5
Sequence
One Letter Code:Biotin-Ahx[LL-37, 37 aa]
Three Letter Code:Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide CDMOPeptide Modification ServicescGMP Peptide ServiceCustom Conjugation ServicePeptide Synthesis ServicesPeptide Analysis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers