LL 37 (human) biotinylated

LL-37 (Human) Biotinylated couples the full-length cathelicidin with a biotin tag for high-affinity immobilization. The peptide retains its amphipathic, α-helical structure, enabling membrane and protein-binding studies. Researchers use streptavidin-based systems to capture complexes and map interaction partners. Applications include antimicrobial-peptide mechanism analysis, pull-down assays, and biosensor development.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2745

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C221H366N64O55S
M.W/Mr.
4832.5
Sequence
One Letter Code:Biotin-Ahx[LL-37, 37 aa]
Three Letter Code:Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

LL 37 (human) biotinylated is a chemically modified version of the naturally occurring human cathelicidin antimicrobial peptide, LL-37, conjugated with a biotin moiety. This biotinylation enables enhanced detection, purification, and immobilization capabilities, making the peptide especially valuable in a wide range of research and analytical applications. The unique structure of LL-37, characterized by its amphipathic alpha-helical conformation, allows it to interact with microbial membranes, nucleic acids, and various cellular receptors. The addition of biotin does not significantly alter its bioactive properties, but it does facilitate its use in systems requiring high-affinity binding through avidin or streptavidin interactions. Researchers often leverage this dual functionality for advanced studies in host defense mechanisms, molecular binding assays, and cell signaling investigations, where precise tracking and recovery of the peptide are essential.

Antimicrobial Mechanism Exploration: LL 37 (human) biotinylated is frequently employed to dissect the molecular mechanisms underlying antimicrobial activities in vitro. By utilizing the biotin tag, scientists can immobilize the peptide on streptavidin-coated surfaces, enabling controlled exposure to bacterial or viral pathogens. This setup allows for detailed analysis of membrane disruption, peptide-pathogen interactions, and the identification of microbial components that mediate resistance or susceptibility. Such studies are pivotal for advancing our understanding of innate immunity and the potential development of novel antimicrobial agents.

Receptor Binding and Cell Signaling Studies: The biotinylated form of LL-37 is a powerful tool for investigating its interactions with cell surface receptors, such as FPR2 and P2X7, which are known to mediate immune cell chemotaxis and inflammatory responses. Through biotin-avidin pull-down assays or surface plasmon resonance, researchers can quantitatively assess binding affinities and kinetics, as well as map the downstream signaling pathways activated by the peptide. These insights are crucial for elucidating the role of LL-37 in modulating immune responses and tissue repair processes.

Protein-Protein Interaction Mapping: LL 37 (human) biotinylated serves as an effective probe in identifying and characterizing protein partners involved in immune regulation and pathogen defense. By coupling the biotinylated peptide to magnetic beads or affinity columns, it is possible to isolate interacting proteins from complex biological samples. Subsequent mass spectrometry or immunoblotting analyses reveal the identity of binding partners, shedding light on the broader functional network of LL-37 in the human body. This approach is instrumental in uncovering novel therapeutic targets and understanding the molecular basis of host-pathogen interactions.

Peptide Localization and Imaging: The biotinylated derivative of LL-37 enables precise localization studies in tissue or cellular environments. Utilizing fluorescently labeled streptavidin, researchers can visualize the distribution of the peptide in live or fixed samples via confocal microscopy or flow cytometry. This application is particularly valuable for tracking the migration, uptake, and intracellular trafficking of LL-37, providing critical information about its functional roles in different cellular contexts and microenvironments.

Affinity Purification and Quantification: LL 37 (human) biotinylated is widely used for the affinity-based purification and quantification of peptide-interacting molecules. By exploiting the strong biotin-streptavidin interaction, scientists can selectively capture the peptide and its complexes from solution, facilitating downstream analyses such as enzyme-linked immunosorbent assays (ELISA) or quantitative mass spectrometry. This methodology streamlines the study of LL-37's binding partners, enhances the specificity of detection, and supports the development of high-throughput screening platforms for modulators or inhibitors of its biological activity. Altogether, the versatility and enhanced functionality provided by biotinylation make LL 37 (human) biotinylated an indispensable reagent in modern biochemical and immunological research.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide CDMOPeptide Analysis ServicesCustom Conjugation ServiceEpitope Mapping ServicesPeptide Synthesis ServicescGMP Peptide ServicePeptide Modification ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers