LL 37 (human) biotinylated

LL-37 (Human) Biotinylated couples the full-length cathelicidin with a biotin tag for high-affinity immobilization. The peptide retains its amphipathic, α-helical structure, enabling membrane and protein-binding studies. Researchers use streptavidin-based systems to capture complexes and map interaction partners. Applications include antimicrobial-peptide mechanism analysis, pull-down assays, and biosensor development.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2745

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C221H366N64O55S
M.W/Mr.
4832.5
Sequence
One Letter Code:Biotin-Ahx[LL-37, 37 aa]
Three Letter Code:Biotin-Ahx- Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

LL 37 (human) biotinylated is a chemically modified form of the human cathelicidin antimicrobial peptide LL-37, featuring a biotin tag for enhanced detection and capture in research applications. As a cationic, amphipathic peptide, LL-37 plays a pivotal role in the innate immune response, exhibiting broad-spectrum antimicrobial activity and modulating various host defense mechanisms. The addition of a biotin moiety allows for facile conjugation to streptavidin-based probes and surfaces, greatly expanding the utility of this peptide in biochemical assays. LL-37's significance extends to studies of host-pathogen interactions, immunomodulation, and cell signaling, making the biotinylated version a valuable tool for advanced experimental designs. Its unique combination of biological activity and chemical accessibility positions it as a key reagent for researchers investigating innate immunity, peptide-receptor interactions, and protein-protein binding events.

Antimicrobial mechanism studies: Biotinylated LL-37 is widely employed in elucidating the mechanisms underlying antimicrobial peptide action against bacteria, fungi, and viruses. By facilitating the precise tracking and localization of the peptide within microbial cultures or infected cell systems, the biotin tag enables researchers to monitor binding, membrane disruption, and internalization events using streptavidin-conjugated detection systems. This approach provides critical insights into the spatial and temporal dynamics of peptide-microbe interactions, supporting the development of new antimicrobial strategies and a deeper understanding of innate host defense.

Protein-protein interaction assays: The biotinylated derivative is particularly advantageous in pull-down assays and affinity purification protocols designed to identify LL-37 binding partners. Immobilization of the peptide on streptavidin-coated matrices allows for efficient capture of interacting proteins from cell lysates or biological fluids. Subsequent analysis of these complexes by mass spectrometry or immunoblotting can reveal previously uncharacterized receptors, co-factors, or regulatory molecules involved in LL-37-mediated signaling pathways, thereby advancing knowledge of its immunomodulatory roles.

Cellular uptake and trafficking studies: Researchers utilize biotinylated LL-37 to investigate peptide uptake, intracellular distribution, and trafficking in mammalian cells. The biotin tag enables sensitive visualization through fluorescence microscopy or flow cytometry when paired with labeled streptavidin, allowing for real-time monitoring of peptide localization and dynamics. These studies are crucial for dissecting the mechanisms of cellular entry, endosomal escape, and the intracellular targets of LL-37, shedding light on its multifaceted biological functions.

Receptor binding analysis: The biotinylated form is also instrumental in quantitative binding assays aimed at characterizing the interactions between LL-37 and cellular receptors. By immobilizing the peptide on biosensor surfaces or microplates, researchers can perform high-throughput screening and kinetic analyses using surface plasmon resonance, ELISA, or similar platforms. Such studies help define the affinity, specificity, and functional consequences of LL-37 engagement with cell surface targets, informing both basic research and potential translational applications.

Immunological pathway exploration: The availability of biotinylated LL-37 supports detailed investigations into the modulation of immune cell function, including chemotaxis, cytokine production, and inflammatory signaling. Its traceability enables precise quantification and localization in complex biological systems, facilitating studies on how LL-37 influences leukocyte recruitment, dendritic cell activation, or epithelial defense mechanisms. These applications contribute to the broader understanding of innate immunity and peptide-mediated regulation of host responses under physiological and pathophysiological conditions.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Epitope Mapping ServicesPeptide Synthesis ServicesPeptide Analysis ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide CDMOcGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers