LL 37 (human) biotinylated, pegylated

LL-37 (Human) Biotinylated, Pegylated combines the full-length human cathelicidin with PEG and biotin tags for enhanced solubility and affinity capture. The PEG segment modulates aggregation and diffusion, while biotin enables streptavidin-based immobilization. Researchers track its interactions with membranes, proteins, or nucleic acids. Applications include antimicrobial-peptide mechanism studies, binding assays, and surface-functionalization work.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R2746

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C226H376N64O59S
M.W/Mr.
4967
Sequence
One Letter Code:Biotin-[PEG(4)][LL-37, 37 aa]
Three Letter Code:Biotin-[PEG(4)]-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Nucleic Acids SynthesisPeptide Modification ServicesPeptide CDMOCustom Conjugation ServicePeptide Analysis ServicesPeptide Synthesis ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers