LL-37, Human TFA

LL-37, Human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, Human TFA could help protect the cornea from infection and modulates wound healing.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1489

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₀₅H₃₄₀N₆₀O₅₃.C₂HF₃O₂
M.W/Mr.
4607.28
Sequence
One Letter Code: [LL-37, 37 aa]
three Letter Code: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

LL-37, Human TFA is a synthetic peptide corresponding to the only human cathelicidin antimicrobial peptide, derived from the C-terminal region of the human CAP18 protein. As a member of the host defense peptide family, LL-37 is characterized by its amphipathic alpha-helical structure and broad-spectrum antimicrobial activity. It plays a multifaceted role in innate immunity, modulating both direct pathogen defense and various aspects of cellular signaling. LL-37 has garnered significant research interest due to its involvement in immune regulation, inflammation, tissue repair, and its emerging relevance in microbial resistance studies.

Antimicrobial research: LL-37 is widely utilized in studies investigating innate immune defense mechanisms against bacteria, viruses, and fungi. Its ability to disrupt microbial membranes through pore formation and membrane destabilization makes it a valuable model for exploring peptide-based antimicrobial strategies. Researchers employ LL-37 in vitro to evaluate its spectrum of activity, resistance mechanisms in pathogens, and its synergistic effects with conventional antibiotics, thereby advancing the understanding of host-pathogen interactions and the development of novel antimicrobial agents.

Immunomodulatory studies: The peptide is instrumental in elucidating the modulation of immune cell responses, including chemotaxis, cytokine release, and the activation of various leukocyte subsets. LL-37's capacity to influence dendritic cell maturation, macrophage polarization, and T-cell recruitment is of particular interest in the context of inflammatory diseases and immune homeostasis. Experimental systems using this peptide enable detailed analysis of signaling pathways such as MAPK and NF-κB, facilitating deeper insights into the molecular mechanisms underpinning immune regulation.

Wound healing and tissue regeneration: LL-37 serves as a critical tool in research models examining epithelial cell migration, angiogenesis, and extracellular matrix remodeling. Its role in promoting re-epithelialization and modulating the activity of growth factors and matrix metalloproteinases is leveraged in both two-dimensional and three-dimensional cell culture systems. By incorporating the peptide into wound healing assays, scientists can dissect its contributions to tissue repair processes and evaluate its potential as a scaffold component in biomaterial development.

Inflammation and autoimmunity studies: The peptide offers a unique platform for investigating the dualistic nature of antimicrobial peptides in both promoting and resolving inflammation. LL-37's interactions with pattern recognition receptors, such as TLRs, and its impact on the formation of neutrophil extracellular traps (NETs) are key areas of exploration. Researchers use it to model chronic inflammatory conditions and to study the peptide's involvement in autoimmune pathogenesis, thereby clarifying its regulatory roles within complex inflammatory networks.

Peptide structure-function analysis: LL-37 is frequently employed in biophysical and structural studies aimed at correlating sequence motifs with biological activity. Its well-characterized alpha-helical conformation and membrane-binding properties make it an ideal candidate for NMR spectroscopy, circular dichroism, and molecular dynamics simulations. These investigations not only enhance the understanding of peptide-membrane interactions but also inform the rational design of synthetic analogs with improved stability or specificity for targeted applications.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesPeptide CDMOEpitope Mapping ServicesPeptide Nucleic Acids SynthesisPeptide Modification ServicesCustom Conjugation ServicePeptide Analysis ServicescGMP Peptide Service
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers