1. Home
  2. Products
  3. Therapeutic Peptides
  4. Peptide Inhibitors
  5. LL-37, Human TFA

LL-37, Human TFA

LL-37, Human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, Human TFA could help protect the cornea from infection and modulates wound healing.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1489

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₀₅H₃₄₀N₆₀O₅₃.C₂HF₃O₂
M.W/Mr.
4607.28
Sequence
One Letter Code: [LL-37, 37 aa]
three Letter Code: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Synthesis ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide Analysis ServicesPeptide CDMOcGMP Peptide ServicePeptide Modification ServicesEpitope Mapping Services
Hot Products
Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Read More Read More
Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

Read More Read More
Argipressin

Argipressin peptide regulates water balance and blood pressure in biological systems. Shop pure Argipressin peptide online for cardiovascular and kidney research.

Read More Read More
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
Deslorelin

Deslorelin peptide is a potent GnRH agonist used for fertility and hormonal control. Buy Deslorelin peptide powder online for veterinary and endocrine research applications.

Read More Read More
Glucagon

Glucagon peptide promotes glycogen breakdown and blood sugar regulation. Buy Glucagon research peptide online for metabolic and liver studies.

Read More Read More
Atosiban

Atosiban is a peptide oxytocin receptor antagonist that helps prevent preterm labor. Buy Atosiban peptide for reproductive and uterine contractility research.

Read More Read More
Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Read More Read More
Angiotensin II Acetate

Angiotensin II Acetate is a potent research peptide regulating blood pressure and vascular tone. Purchase this synthetic peptide to support cardiovascular and renal studies.

Read More Read More
Alarelin acetate

Alarelin Acetate is a high-purity synthetic peptide used in fertility and ovulation research. Buy Alarelin peptide online from a trusted peptide supplier for advanced hormonal studies.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers