LL-37, Human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, Human TFA could help protect the cornea from infection and modulates wound healing.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C₂₀₅H₃₄₀N₆₀O₅₃.C₂HF₃O₂ |
M.W/Mr. | 4607.28 |
Sequence | One Letter Code: [LL-37, 37 aa] three Letter Code: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
1. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
2. Emerging applications of nanotechnology for diagnosis and therapy of disease: a review
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.