LL-37 scrambled peptide

LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. Scrambled peptide is random permutation of the original peptide that can be used as negative control or screening tool in research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1486

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C205H340N60O53
M.W/Mr.
4493.30
Sequence
One Letter Code: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Three Letter Code: Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg
Purity
≥97% (HPLC)

LL-37 scrambled peptide is a synthetic peptide derivative designed by altering the amino acid sequence of the native LL-37 antimicrobial peptide, resulting in a sequence with similar composition but lacking the specific biological activity of the parent molecule. As a negative control tool in peptide research, the scrambled variant provides a critical benchmark for distinguishing sequence-specific effects from general peptide properties. Its inert profile with respect to the canonical functions of LL-37 makes it highly relevant for mechanistic studies in immunology, microbiology, and cell biology, where precise attribution of observed effects is essential for scientific rigor.

Negative control in antimicrobial assays: In studies investigating the antimicrobial properties of host defense peptides, the scrambled version of LL-37 is routinely employed as a negative control. By comparing the biological responses elicited by the native peptide and its scrambled counterpart, researchers can confirm that observed antimicrobial effects are due to the specific sequence and structure of LL-37 rather than non-specific peptide features. This approach is fundamental for validating experimental outcomes in bactericidal, fungicidal, and membrane disruption assays.

Mechanistic studies of peptide-membrane interactions: The scrambled peptide serves as an essential comparator in experiments probing the mechanisms of peptide-membrane interactions. By incorporating it into liposome leakage assays, membrane potential measurements, or surface plasmon resonance studies, scientists can discern whether membrane perturbation is sequence-dependent. The use of the scrambled sequence helps clarify whether the parent peptide's activity is mediated by targeted interactions or by general physicochemical properties such as charge or hydrophobicity.

Cell signaling and immunomodulation research: In immunology and cell signaling research, the scrambled form is used to control for non-specific cellular responses when assessing the immunomodulatory activities of LL-37. Its inclusion in cytokine release assays, chemotaxis studies, or receptor activation experiments enables the exclusion of artifacts arising from peptide charge, length, or general peptide presence. This ensures that any observed modulation of immune cell behavior is attributable to the native sequence rather than generic peptide effects.

Peptide uptake and localization assays: Use of the scrambled peptide in cellular uptake and localization experiments provides a baseline for interpreting the internalization and distribution of sequence-specific peptides. By fluorescently labeling both the native and scrambled forms, researchers can compare their cellular trafficking and localization patterns, distinguishing sequence-driven uptake mechanisms from non-specific endocytosis or adsorption. This application is particularly valuable in developing peptide-based delivery systems or studying intracellular peptide dynamics.

Optimization of assay specificity and reproducibility: Incorporating the scrambled sequence into experimental workflows enhances the specificity and reproducibility of peptide-based assays. Its deployment as a standard negative control across diverse platforms—ranging from high-throughput screening to single-cell analyses—enables robust differentiation between true biological effects and background noise. This practice supports the generation of reliable, interpretable data, facilitating the advancement of peptide science and the development of novel peptide-based technologies.

Shipping Condition
+20°C (International: -20°C)

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Analysis ServicesPeptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Synthesis ServicesPeptide CDMOcGMP Peptide ServicePeptide Modification ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers