LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. Scrambled peptide is random permutation of the original peptide that can be used as negative control or screening tool in research.
CAT# | R1486 |
M.F/Formula | C205H340N60O53 |
M.W/Mr. | 4493.30 |
Sequence | One Letter Code: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR Three Letter Code: Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg |
Purity | ≥97% (HPLC) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...
Conantokin-T (Gly-Glu-Gla-Gla-Tyr-Gln-Lys-Met-Leu-Gla-Asn-Leu-Arg-Gla-Ala-Glu-Val-Lys-Asn-Ala-NH2), a 21-amino a ...
GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...