LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. Scrambled peptide is random permutation of the original peptide that can be used as negative control or screening tool in research.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C205H340N60O53 |
M.W/Mr. | 4493.30 |
Sequence | One Letter Code: GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR Three Letter Code: Gly-Leu-Lys-Leu-Arg-Phe-Glu-Phe-Ser-Lys-Ile-Lys-Gly-Glu-Phe-Leu-Lys-Thr-Pro-Glu-Val-Arg-Phe-Arg-Asp-Ile-Lys-Leu-Lys-Asp-Asn-Arg-Ile-Ser-Val-Gln-Arg |
Purity | ≥97% (HPLC) |
Shipping Condition | +20°C (International: -20°C) |
1. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
3. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
5. Cationic cell-penetrating peptides are potent furin inhibitors
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.