CAT# | AF3310 |
Sequence | ATTGCSCPQCIIFDPICASSYKNGRRGFSSGCHMRCYNRCHGTDYFQISKGSKCI |
Activity | Gram+, |
Host Chemicals | Migratory locust | Length | 55 | SwissProt ID | SwissProt ID: P83428 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF1419 | XT-2 | Inquiry | ||
AF3054 | Beta-defensin 107A | Inquiry | ||
AF2982 | RprDefB | Inquiry | ||
AF3317 | CCL27 | Inquiry | ||
AF774 | Ranalexin-1Ca | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Background Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be acc ...
APC 366 [N-(1-hydroxy-2-naphthoyl)-L-arginyl-L-prolinamide], is a novel selective inhibitor of mast cell tryptas ...
Cyclotraxin B , a potent antagonist of TrkB receptors, inhibits BDNF-induced TrkB activity (IC50 = 0.30 nM). R ...
Palmitoyl Tripeptide-1 is also called Part of Matrixyl 3000. Palmitoyl Oligopeptide and Pal-GHK are believed to be able to st ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...