Home > Product > Antimicrobial Peptides > Locustin

Antimicrobial Peptides

CAT#
AF3310
Sequence
ATTGCSCPQCIIFDPICASSYKNGRRGFSSGCHMRCYNRCHGTDYFQISKGSKCI
Host Chemicals
Migratory locust
Length
55
Activity
Gram+,
SwissProt ID
SwissProt ID: P83428

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.