Keywords Search Google Search Search

Moricin-like peptide C3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2724
Sequence	KVPIGAIKKGGKIIKKGLGVIGAAGTAHEVYSHVKNRQ
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF481	Antifungal protein 2 small subunit	Inquiry
AF548	Bombin H7	Inquiry
AF132	Halictine 1	Inquiry
AF3260	Apl-AvBD16	Inquiry
AF2682	Bacteriocin L-1077	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of DAMME in analgesia

DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...

Huwentoxin IV, A Kind of Selective NaV1.7 Channel Blocker

Huwentoxin IV, a 35-amino-acid-residue polypeptide from Chinese tarantula Ornithoctonus huwena venom, is a kind ...

Palmitoyl Tripeptide-5

of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...

Palmitoyl pentapeptide-4

An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...

Function of sinapultide in respiratory distress syndrome

Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Galleria mellonella
Length	38
SwissProt ID	A5JSU9