Nesfatin-1 (rat)

Nesfatin-1 (rat) is a rat-specific fragment of NUCB2 implicated in metabolic and stress-related signaling. Its sequence supports helix–loop–helix analyses and receptor-binding studies. Researchers employ it to compare structural and functional differences with human nesfatin-1. The peptide aids characterization of rodent neuroendocrine regulatory pathways.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: N01001

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C424H684N116O136
M.W/Mr.
9582.80
Sequence
VPIDVDKTKVHNVEPVESARIEPPDTGLYYDEYLKQVIEVLETDPHFREKLQKADIEEIRSGR
Length
63

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Analysis ServicesCustom Conjugation ServicePeptide Nucleic Acids SynthesisPeptide CDMOEpitope Mapping ServicesPeptide Synthesis ServicesPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers