Keywords Search Google Search Search

[Nle11]-Substance P

[Nle11]-Substance P is a substance P analog that avoids methionine oxidation problems.

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	R1126
CAS	57462-42-7
M.F/Formula	C₆₄H₁₀₀N₁₈O₁₃
M.W/Mr.	1329.59
Sequence	One Letter Code: RPKPQQFFGL-NLE-NH2 three Letter Code: Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-NLE-NH2

CAT#	Product Name	Inquiry
R1365	FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	Inquiry
R1239	BMf-BH3	Inquiry
R1237	Bim BH3, Peptide IV	Inquiry
R1861	Foxy-5	Inquiry
R1860	CGRP (8-37), human	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The Second-generation Antagonist, GR 82334

GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...

The effect of Sincalide on gastric movement

Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...

Orexin Peptides

Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...

Bombesin and Bombesin-like peptides

Brief information of bombesin Bombesin is a tetradecapeptide which was originally isolated from Bombina Bombina frog skin the ...

A synthetic analogue of vasopressin - felypressin

Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: