Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GKVWDWIKSTAKKLWNSEPVKELKNTALNAAKNFVAEKIGATPS |
Activity | Antibacterial, Antifungal |
Host Chemicals | Opistophthalmus carinatus |
Length | 44 |
SwissProt ID | P83314 |
1. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
2. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.