Oxyntomodulin / Glucagon 37

CAT#	G05010
M.F/Formula	C192H295N59O60S1
M.W/Mr.	4421.9
Sequence	SQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA

Length

36

CAT#	Product Name	M.W	Molecular Formula	Inquiry
G16017	Biotinyl-Glucagon (1-29) (human, rat, porcine)			Inquiry
10-101-158	Albiglutide			Inquiry
10-101-83	Exendin (9-39) Acetate			Inquiry
G05001	Glucagon (22-29), human			Inquiry
10-101-59	Liraglutide			Inquiry

1. P-selectin and Complement’s Role in a Neonatal Model of Germinal Matrix Hemorrhage-Induced Secondary Injury

2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate

3. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die

4. Spatiotemporal delivery of nanoformulated liraglutide for cardiac regeneration after myocardial infarction

5. Myotropic activity of allatostatins in tenebrionid beetles