CAT# | G05010 |
M.F/Formula | C192H295N59O60S1 |
M.W/Mr. | 4421.9 |
Sequence | SQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Length | 36 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
G16017 | Biotinyl-Glucagon (1-29) (human, rat, porcine) | Inquiry | ||
10-101-158 | Albiglutide | Inquiry | ||
10-101-83 | Exendin (9-39) Acetate | Inquiry | ||
G05001 | Glucagon (22-29), human | Inquiry | ||
10-101-59 | Liraglutide | Inquiry |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).