Oxyntomodulin / Glucagon 37
Oxyntomodulin / Glucagon 37
Online Inquiry
| CAT# | G05010 |
| M.F/Formula | C192H295N59O60S1 |
| M.W/Mr. | 4421.9 |
| Sequence | SQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| G05006 |
[Des - His1, Glu9] - Glucagon (1 - 29), amide |
|
|
Inquiry |
| G16005 |
Glucagon - Like Peptide 1, GLP - 1 (7 - 37) |
|
|
Inquiry |
| G16018 |
GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) |
|
|
Inquiry |
| G16024 |
GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat) |
|
|
Inquiry |
| G16013 |
(Des-Thr5)-Glucagon |
|
|
Inquiry |
Write a review
Ask a question
My Review for Oxyntomodulin / Glucagon 37
Required fields are marked with *
×
Ask a Question for Oxyntomodulin / Glucagon 37
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
