PACAP (1-27), human, ovine, rat

PACAP (1-27), human, ovine, rat, the N-terminal fragment of PACAP-38, is a potent PACAP receptor antagonist with IC50s of 3, 2, and 5 nM, respectively, for rat PAC1, rat VPAC1, and human VPAC2.

Online Inquiry

CAT#R1590
CAS127317-03-7
Synonyms/AliasPACAP 1-27, Pituitary Adenylate Cyclase Activating Polypeptide,
M.F/FormulaC142H224N40O39S
M.W/Mr.3147.66
SequenceOne Letter Code: HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2
Three Letter Code: His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2
AppearanceWhite to off-white solid
Purity≥98% by HPLC
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Contact Us

Address:

Tel: |

Email:

Copyright © 2022 Creative Peptides. All rights reserved.