PACAP (1-38), human, ovine, rat

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1591

CAS No:137061-48-4

Synonyms/Alias:Pituitary Adenylate Cyclase Activating Polypeptide 38

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₀₃H₃₃₁N₆₃O₅₃S
M.W/Mr.
4534.26
Sequence
One Letter Code: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
three Letter Code: His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2

PACAP (1-38), human, ovine, rat is a highly conserved neuropeptide belonging to the vasoactive intestinal peptide (VIP)/secretin/glucagon family, characterized by its 38-amino acid sequence. It is found across multiple species, including humans, sheep (ovine), and rats, and is recognized for its potent biological activities in the central and peripheral nervous systems. PACAP (1-38) acts primarily through G protein-coupled receptors, notably PAC1, VPAC1, and VPAC2, modulating a wide array of physiological processes such as neurotransmission, neuroprotection, and cellular signaling. Its evolutionary conservation and pleiotropic functions have made it a key focus in molecular neuroscience, endocrinology, and peptide signaling research.

Neuroscience research: PACAP (1-38) is widely utilized in studies investigating neuronal signaling pathways and neuropeptide receptor interactions. By applying this peptide to primary neuronal cultures or brain tissue slices, researchers can examine its effects on synaptic transmission, neuronal excitability, and intracellular signaling cascades. These investigations help elucidate the fundamental roles of PACAP in neuroprotection, neurodevelopment, and plasticity, providing valuable insights into mechanisms underlying brain function and dysfunction.

Receptor pharmacology: The peptide serves as a critical tool for characterizing PAC1, VPAC1, and VPAC2 receptor subtypes. In vitro binding assays, receptor activation studies, and downstream second messenger analyses benefit from the use of PACAP (1-38) as a selective agonist. Such experiments enable detailed mapping of receptor distribution, ligand specificity, and signal transduction pathways, supporting the development of receptor-targeted probes and advancing understanding of peptide-receptor dynamics in various tissues.

Endocrine system investigations: PACAP (1-38) plays a significant role in modulating hormone secretion and intracellular signaling within endocrine tissues. It is frequently employed in studies exploring the regulation of pituitary, adrenal, and pancreatic function, where it influences the synthesis and release of key hormones. By applying this peptide in ex vivo or cell-based models, researchers can dissect the molecular mechanisms by which neuropeptides control endocrine responses and homeostasis.

Peptide structure-function analysis: The availability of PACAP (1-38) from multiple species allows for comparative studies of sequence conservation and functional divergence. Researchers use it to perform structure-activity relationship (SAR) experiments, including alanine scanning, truncation, or site-directed mutagenesis, to identify critical residues responsible for biological activity. These analyses inform the rational design of peptide analogs, antagonists, and receptor-selective ligands, supporting both basic science and translational research.

Signal transduction studies: PACAP (1-38) is employed to probe intracellular signaling networks initiated by peptide-receptor engagement. By monitoring downstream effectors such as cyclic AMP, calcium flux, and protein kinase activation, investigators can delineate the specific pathways modulated by this neuropeptide in different cell types. These studies contribute to a comprehensive understanding of how neuropeptides orchestrate complex cellular responses, offering a foundation for future research into cell signaling mechanisms and peptide-based modulation strategies.

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServiceEpitope Mapping ServicesPeptide Modification ServicesPeptide Synthesis ServicesPeptide CDMOCustom Conjugation ServicePeptide Analysis ServicesPeptide Nucleic Acids Synthesis
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers