Pancreastatin, porcine

Pancreastatin, porcine encompasses the full porcine peptide sequence associated with endocrine regulatory roles. The amino-acid composition supports studies of helix formation, receptor recognition, and enzymatic cleavage. Researchers employ it to probe cross-species structural divergences. Its extended framework aids in modeling peptide-protein interactions.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: P01002

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C214H330N68O76S1
M.W/Mr.
5103.5
Sequence
GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2
Length
49

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisCustom Conjugation ServicePeptide Synthesis ServicesEpitope Mapping ServicesPeptide CDMOPeptide Analysis ServicescGMP Peptide ServicePeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers