CAT# | P01002 |
M.F/Formula | C214H330N68O76S1 |
M.W/Mr. | 5103.5 |
Sequence | GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...
Afamelanotide, a drug for tanning skin, is a synthetic peptide and analogue of α-melanocyte stimulating hormone. ...
Ornithoctonus huwena, Chinese tarantula, is one of the most venomous spiders in China, and its venom can kill in ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...