CAT# | AF3047 |
Sequence | YDTGIQGWTCGSRGLCRKHCYAQEHTVGYHGCPRRYRCCALRF |
Activity | Gram+ & Gram-, |
Host Chemicals | Chinese loach, Paramisgurnus dabryanus | Length | 43 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF513 | Jingdongin-1 antimicrobial peptide precursor | Inquiry | ||
AF2235 | Brevinin-2-RA20 antimicrobial peptide | Inquiry | ||
AF323 | OdR1 | Inquiry | ||
AF253 | DFTamP1 | Inquiry | ||
AF3275 | Ac-AFP3 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
GsMTx4 is a synthetic and biologically active peptide toxin. Its molecular formula is C185H273N49O45S6, with the ...
Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
Delcasertib, also known as KAI-9803, is a 23-amino acid peptide and δ-protein kinase C (δ-PKC) inhibitor. KAI-9 ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...