Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QGCKGPYTRPILRPYVRPVVSYNACTLSCRGITTTQARSCCTRLGRCCHVAKGYS |
Activity | Gram+, Fungi, |
Host Chemicals | Atlantic white shrimp, Litopenaeus setiferus (formerly Penaeus setiferus) |
Length | 55 |
SwissProt ID | SwissProt ID: Q962B1 |
3. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.