Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QGYKGPYTRPILRPYVRPVVSYNACTLSCRGITTTQARSCSTRLGRCCHVAKGYS |
Activity | Gram+, Fungi, |
Host Chemicals | Atlantic white shrimp, Litopenaeus setiferus (formerly Penaeus setiferus) |
Length | 55 |
SwissProt ID | SwissProt ID: Q962B0 |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.