CAT# | V02013 |
M.F/Formula | C136H216N36O41 |
M.W/Mr. | 3011.43 |
Sequence | HADGVFTSDYSRLLGQISAKKYLESLI-NH2 |
Length | 27 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
V1312 | Biotinyl-VIP (human, mouse, rat) | Inquiry | ||
V1320 | Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27) | Inquiry | ||
V02011 | VIP (4-28) (human, bovine, porcine, rat) | Inquiry | ||
V1313 | (Ala11.22.28)-VIP (human, mouse, rat) | Inquiry | ||
V02009 | VIP (6-28) (human, bovine, porcine, rat) | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
2. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum
4. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs
5. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...
ClC-2 chloride channels are voltage-gated ion channels that are expressed in neuronal and epithelial cells wher ...
Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...
Taltirelin is a thyrotropin-releasing hormone (TRH) analog that binds the brain BRH receptors in vivo. Taltireli ...