Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | LARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ |
Length | 48 |
2. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.