Keywords Search Google Search Search

Ponericin-G3

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF1956
Sequence	GWKDWLNKGKEWLKKKGPGIMKAALKAATQ
Activity	Antibacterial, Antifungal

CAT#	Product Name	Inquiry
AF1884	Lantibiotic lacticin 3147 A1	Inquiry
AF2823	Beta-defensin 10 , BNBD-10	Inquiry
AF428	Lasioglossin LL-III	Inquiry
AF3241	HIMS-Defensin	Inquiry
AF1870	Bacteriocin As-48	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

The role of Act1 in NF-кB activation

NF-кB activator 1, named Act1, is a 60-kDa (574-aa) polypeptide. Based on its interaction with IKKγ, Act1can be ...

Ornipressin: a synthetic derivative of vasopressin

Figure 1. The structural formula of ornipressinOrnipressin is a synthetic analogue of vasopressin, which is repl ...

A Cellular Gβγ Antagonist, GRK2i

GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...

Function of FC 131 as CXCR4 antagonists

The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...

Function of R8-T198wt in prostate cancer

The serine/threonine kinase Pim-1 plays an important role in cell cycle progression and apoptosis inhibition, re ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Pachycondyla goeldii
Length	30
SwissProt ID	P82416