Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | GWKDWLNKGKEWLKKKGPGIMKAALKAATQ |
Activity | Antibacterial, Antifungal |
Host Chemicals | Pachycondyla goeldii |
Length | 30 |
SwissProt ID | P82416 |
1. TMEM16F and dynamins control expansive plasma membrane reservoirs
4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.