Home > Product > Catalog Peptides > Others > Prosomatostatin (1-32), porcine

Others

Prosomatostatin (1-32), porcine

Price Inquiry
CAT#
S07007
Sequence
APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL
M.W/Mr.
3532.1
Molecular Formula
C161H260N44O45
Length
32

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.