Prosomatostatin (1-32), porcine

Prosomatostatin (1-32), porcine, defines an early region of the precursor involved in folding and segmental processing. Sequence architecture supports receptor-binding and cleavage studies. Dynamic conformations highlight biosynthetic intermediates. Researchers employ it in neuropeptide pathway modeling and structural-function research.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: S07007

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C161H260N44O45
M.W/Mr.
3532.1
Sequence
APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL
Length
32

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Modification ServicescGMP Peptide ServicePeptide CDMOPeptide Analysis ServicesPeptide Nucleic Acids SynthesisEpitope Mapping ServicesCustom Conjugation ServicePeptide Synthesis Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers