Psalmotoxin 1, a protein toxin from a tarantula, inhibits H+-gated acid-sensing ion channel (ASIC1a).
CAT# | R1646 |
Synonyms/Alias | PcTx1; Psalmopoeus cambridgei toxin-1 |
M.F/Formula | C₂₀₀H₃₁₂N₆₂O₅₇S₆ |
M.W/Mr. | 4689.41 |
Sequence | One Letter Code: EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Arg28, Arg17-Ser33) three Letter Code: Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr(Disulfide bridge: Cys3-Cys18, Cys10-Arg28, Arg17-Ser33) |
Labeling Target | Acid-sensing ion channel 1a (ASIC1a) |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Peginesatide sold under the brand name Omontys, formerly Hematide, is a synthetic peptide consisting of two 21 a ...
Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...
ProTx II, a 30-amino acid, disulfide-rich peptide toxin, isolated from the venom of the tarantula, Thrixopelma ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...