Psalmotoxin 1

Psalmotoxin 1, a protein toxin from a tarantula, inhibits H+-gated acid-sensing ion channel (ASIC1a).

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: R1646

Synonyms/Alias:PcTx1; Psalmopoeus cambridgei toxin-1

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.F/Formula
C₂₀₀H₃₁₂N₆₂O₅₇S₆
M.W/Mr.
4689.41
Sequence
One Letter Code: EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT (Disulfide bridge: Cys3-Cys18, Cys10-Arg28, Arg17-Ser33)
three Letter Code: Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr(Disulfide bridge: Cys3-Cys18, Cys10-Arg28, Arg17-Ser33)
Labeling Target
Acid-sensing ion channel 1a (ASIC1a)
Appearance
White lyophilised solid
Purity
>98%
Activity
Blocker

Psalmotoxin 1 is a peptide toxin originally isolated from the venom of the Trinidad chevron tarantula, Psalmopoeus cambridgei. As a member of the inhibitor cystine knot (ICK) peptide family, it is characterized by a stable, disulfide-rich structure and potent biological activity. The compound is renowned for its high-affinity and selective inhibition of acid-sensing ion channel 1a (ASIC1a), a proton-gated cation channel implicated in a wide array of physiological and pathophysiological processes. Its unique molecular properties and precise targeting capabilities have made Psalmotoxin 1 an indispensable tool in neurobiological research and ion channel studies, enabling scientists to dissect complex signaling pathways and elucidate the functional roles of ASICs in both normal and disease states.

Ion channel research: As a highly selective modulator of ASIC1a, Psalmotoxin 1 is extensively employed in studies aiming to characterize the structure, function, and pharmacology of acid-sensing ion channels. By binding to the extracellular domain of ASIC1a and inhibiting its activity, the peptide allows researchers to probe the channel's physiological roles in neuronal excitability, synaptic plasticity, and sensory perception. Its use facilitates the dissection of ASIC1a-specific contributions within complex ion channel networks, advancing the understanding of proton signaling in neural and non-neural tissues.

Neuroprotection mechanisms: The ability of Psalmotoxin 1 to block ASIC1a has made it a valuable agent for investigating cellular responses to acidosis and ischemic conditions in neural tissue. In experimental models, its application enables the study of ASIC1a-mediated calcium influx and downstream signaling events that contribute to neuronal injury. By selectively inhibiting this pathway, researchers can differentiate ASIC-dependent effects from other excitotoxic mechanisms, providing insight into the molecular underpinnings of neurodegeneration and potential targets for intervention.

Pain signaling studies: The peptide's specificity for ASIC1a offers a precise approach for examining the role of acid-sensing ion channels in nociception and pain transduction. Experimental use of Psalmotoxin 1 in in vitro and ex vivo preparations allows for the dissection of ASIC1a's involvement in sensory neuron activation, hyperalgesia, and inflammatory pain responses. Such studies are essential for mapping the molecular pathways underlying pain perception and for identifying novel modulators of nociceptive signaling.

Pharmacological screening: Due to its well-characterized interaction with ASIC1a, Psalmotoxin 1 serves as a reference inhibitor in pharmacological assays designed to screen for new ASIC modulators. Its inclusion in high-throughput or mechanistic studies provides a benchmark for evaluating the potency and selectivity of candidate compounds. This application is particularly valuable for the development of new research tools and for expanding the repertoire of ASIC-targeting molecules available to the scientific community.

Peptide engineering and structural biology: The robust and stable cystine knot scaffold of Psalmotoxin 1 makes it an attractive template for the design of engineered peptides with improved pharmacological or biophysical properties. Structural studies utilizing this peptide contribute to a deeper understanding of toxin-channel interactions and inform rational design strategies for novel ligands. Researchers leverage its defined tertiary structure to investigate disulfide bond formation, folding pathways, and the principles governing peptide stability, thereby advancing the broader field of peptide-based molecular engineering.

Source#
Synthetic
Long-term Storage Conditions
Soluble water and saline buffer
InChI
InChI=1S/C200H312N62O57S6/c1-13-102(10)157-194(316)261-74-36-54-142(261)189(311)239-116(46-23-28-66-203)167(289)244-128(78-106-84-221-112-42-19-17-40-109(106)112)176(298)230-114(44-21-26-64-201)161(283)223-89-147(269)229-135-91-320-321-93-137-183(305)245-129(79-107-85-222-113-43-20-18-41-110(107)113)177(299)234-115(45-22-27-65-202)164(286)231-119(49-31-69-217-197(208)209)165(287)232-120(50-32-70-218-198(210)211)166(288)233-122(52-34-72-220-200(214)215)169(291)248-134(90-263)181(303)243-127(77-105-38-15-14-16-39-105)175(297)238-125(59-63-151(276)277)173(295)254-155(100(6)7)192(314)253-140(186(308)256-156(101(8)9)193(315)260-73-35-53-141(260)188(310)240-117(47-24-29-67-204)171(293)258-158(103(11)264)195(317)262-75-37-55-143(262)190(312)241-118(48-25-30-68-205)172(294)259-159(104(12)265)196(318)319)96-325-323-94-138(250-179(301)132(82-152(278)279)228-146(268)88-225-163(285)130(80-108-86-216-97-226-108)246-168(290)121(51-33-71-219-199(212)213)235-178(300)131(81-144(207)266)247-191(313)154(99(4)5)255-185(135)307)184(306)252-136(92-322-324-95-139(187(309)257-157)251-180(302)133(83-153(280)281)242-160(282)111(206)56-60-148(270)271)182(304)236-123(57-61-149(272)273)162(284)224-87-145(267)227-126(76-98(2)3)174(296)237-124(170(292)249-137)58-62-150(274)275/h14-20,38-43,84-86,97-104,111,114-143,154-159,221-222,263-265H,13,21-37,44-83,87-96,201-206H2,1-12H3,(H2,207,266)(H,216,226)(H,223,283)(H,224,284)(H,225,285)(H,227,267)(H,228,268)(H,229,269)(H,230,298)(H,231,286)(H,232,287)(H,233,288)(H,234,299)(H,235,300)(H,236,304)(H,237,296)(H,238,297)(H,239,311)(H,240,310)(H,241,312)(H,242,282)(H,243,303)(H,244,289)(H,245,305)(H,246,290)(H,247,313)(H,248,291)(H,249,292)(H,250,301)(H,251,302)(H,252,306)(H,253,314)(H,254,295)(H,255,307)(H,256,308)(H,257,309)(H,258,293)(H,259,294)(H,270,271)(H,272,273)(H,274,275)(H,276,277)(H,278,279)(H,280,281)(H,318,319)(H4,208,209,217)(H4,210,211,218)(H4,212,213,219)(H4,214,215,220)
InChI Key
LICLJUGDURFZIM-UHFFFAOYSA-N
References

Psalmotoxin-1 activates cASIC1, which is unexpected as the chicken ASIC protein shares considerable sequence homology (89%) to human and rat ASIC1a and less homology to ASIC1b.4 Both the human and rat ASIC1a subtypes are antagonized by PcTx1 under normal conditions. Chen and Grunder have shown that PcTx1 activation can by observed in ASIC1a by lowering calcium.

Protons and Psalmotoxin-1 reveal nonproton ligand stimulatory sites in chicken acid-sensing ion channel

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
cGMP Peptide ServicePeptide Synthesis ServicesEpitope Mapping ServicesPeptide Analysis ServicesCustom Conjugation ServicePeptide CDMOPeptide Nucleic Acids SynthesisPeptide Modification Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers