Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ATCDLFSFRSKWVTPNHAACAAHCLLRGNRGGRCKGTICHCRK |
Activity | Antibacterial |
Host Chemicals | Rhodnius prolixus |
Length | 43 |
3. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
4. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.