Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC |
Activity | Fungi, |
Host Chemicals | Radish seeds, Raphanus sativus, Brassicaceae species |
Length | 51 |
SwissProt ID | PDB ID: 1AYJ |
1. Implications of ligand-receptor binding kinetics on GLP-1R signalling
5. C-Peptide replacement therapy and sensory nerve function in type 1 diabetic neuropathy
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.