Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP)

Name: Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP)
Brand: Creative Peptides
SKU: X21185
Availability: MadeToOrder

This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: X21185

Custom Peptide Synthesis

cGMP Peptide

Registration of APIs
CMC information required for an IND

IND and NDA support
Drug master files (DMF) filing

M.W/Mr.

3616.6

Sequence

One Letter Code: KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
Three Letter Code: H-Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn-OH

References

Kovaks, E. et al. J Biol Chem 285, 1799 (2010).

1. An Open-label, Single-center, Safety and Efficacy Study of Eyelash Polygrowth Factor Serum

2. SERS spectrum of the peptide thymosin‐β4 obtained with Ag nanorod substrate

3. Cationic cell-penetrating peptides are potent furin inhibitors

4. The effect of B-type allatostatin neuropeptides on crosstalk between the insect immune response and cold tolerance

5. Investigating Potential Interactions Between Neurohypophyseal Peptides, their Drug Analogs, and Coagulation Factor VIII

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services

Peptide CDMO Peptide Modification Services cGMP Peptide Service Custom Conjugation Service Peptide Analysis Services Epitope Mapping Services Peptide Synthesis Services Peptide Nucleic Acids Synthesis

Hot Products

Alarelin acetate

Alarelin Acetate is a high-purity synthetic peptide used in fertility and ovulation research. Buy Alarelin peptide online from a trusted peptide supplier for advanced hormonal studies.

Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Icatibant

Icatibant is a potent bradykinin B2 receptor antagonist peptide for inflammation and allergy research. Buy Icatibant peptide from a reliable peptide supplier to support biomedical studies.

Deslorelin

Deslorelin peptide is a potent GnRH agonist used for fertility and hormonal control. Buy Deslorelin peptide powder online for veterinary and endocrine research applications.

Teduglutide

Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.

Thymopentin Acetate

Thymopentin Acetate peptide enhances immune modulation and T-cell function. Purchase Thymopentin research peptide online for immunotherapy and cell biology research.

Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Fertirelin Acetate

Fertirelin Acetate is a synthetic peptide that promotes ovulation and fertility. Purchase Fertirelin research peptide for breeding and hormonal studies.

Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers