Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP)

Name: Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP)
Brand: Creative Peptides
SKU: X21185
Availability: MadeToOrder

This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: X21185

Custom Peptide Synthesis

cGMP Peptide

Registration of APIs
CMC information required for an IND

IND and NDA support
Drug master files (DMF) filing

M.W/Mr.

3616.6

Sequence

One Letter Code: KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
Three Letter Code: H-Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn-OH

References

Kovaks, E. et al. J Biol Chem 285, 1799 (2010).

1. Store-operated Ca2+ entry sustains the fertilization Ca2+ signal in pig eggs

2. Characterization of Novel P-Selectin Targeted Complement Inhibitors in Murine Models of Hindlimb Injury and Transplantation

3. High fat diet and GLP-1 drugs induce pancreatic injury in mice

4. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment

5. Immune responses to peptides containing homocitrulline or citrulline in the DR4-transgenic mouse model of rheumatoid arthritis

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services

Peptide Analysis Services Peptide Synthesis Services Peptide Nucleic Acids Synthesis Custom Conjugation Service Peptide Modification Services cGMP Peptide Service Epitope Mapping Services Peptide CDMO

Hot Products

Teduglutide

Teduglutide peptide enhances intestinal absorption and mucosal growth. Buy Teduglutide research peptide to support gastrointestinal and metabolic studies.

GLP-1 (7-36) amide Acetate

GLP-1 (7-36) amide Acetate peptide enhances insulin secretion and glucose balance. Buy this research peptide for diabetes and metabolic disorder studies.

Angiotensin II

Angiotensin II peptide regulates blood pressure and vascular constriction. Purchase this synthetic research peptide to support cardiovascular and renal function studies.

Aviptadil Acetate

Aviptadil Acetate is a vasoactive intestinal peptide for lung and immune research. Purchase this synthetic peptide for studies on pulmonary health and inflammation.

Gonadorelin Acetate

Gonadorelin Acetate stimulates LH and FSH release in fertility research. Purchase Gonadorelin peptide powder from a verified peptide supplier for reproductive studies.

Lanreotide Acetate

Lanreotide Acetate is a somatostatin analog peptide regulating hormone secretion. Purchase Lanreotide peptide online to study tumor suppression and endocrine disorders.

Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

GLP-1 (7-37) Acetate

GLP-1 (7-37) Acetate is a synthetic peptide for appetite and insulin regulation. Order GLP-1 peptide powder from a trusted supplier for metabolic research.

Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers