This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 3616.6 |
Sequence | One Letter Code: KSKKAVWHKLLSKQRRRAVVACFRMTPLYN Three Letter Code: H-Lys-Ser-Lys-Lys-Ala-Val-Trp-His-Lys-Leu-Leu-Ser-Lys-Gln-Arg-Arg-Arg-Ala-Val-Val-Ala-Cys-Phe-Arg-Met-Thr-Pro-Leu-Tyr-Asn-OH |
References | Kovaks, E. et al. J Biol Chem 285, 1799 (2010). |
1. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
2. Emu oil in combination with other active ingredients for treating skin imperfections
Required fields are marked with *
×Required fields are marked with *
×If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com