Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
Sequence | ELPKLPDDKVLIRSRSNCPKGKVWNGFDCKSPFAFS |
Activity | Antibacterial, Antifungal |
Host Chemicals | Oryctes rhinoceros |
Length | 36 |
SwissProt ID | Q86SC0 |
1. High fat diet and GLP-1 drugs induce pancreatic injury in mice
5. Adipose tissue is a key organ for the beneficial effects of GLP-2 metabolic function
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.