SHLP3 (Small humanin-like peptide 3)
SHLP3 (Small humanin-like peptide 3)
Recent advances in high-resolution sequencing have led to the discovery of unique peptides derived from mitochondrial genome. 1-2 Currently 8 peptides are identified: humanin, mitochondrial open reading frame of the 12S tRNA-c (MOTS-c), and six small humanin-like peptides (SHLP1-6). 1-2 All of these peptides are released into cytosol from mitochondria. SHLP3 shares protective effects with Humanin, such as eduction in apoptosis, generation of reactive oxygen species and improving mitochondrial metabolism. In addition, it may participate in age-related disease pathology. 1-2
Online Inquiry
| CAT# | X21190 |
| M.W/Mr. | 4380.4 |
| Sequence | One Letter Code: H-MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW-OH
Three Letter Code: NH2-Met-Leu-Gly-Tyr-Asn-Phe-Ser-Ser-Phe-Pro-Cys-Gly-Thr-Ile-Ser-Ile-Ala-Pro-Gly-Phe-Asn-Phe-Tyr-Arg-Leu-Tyr-Phe-Ile-Trp-Val-Asn-Gly-Leu-Ala-Lys-Val-Val-Trp-COOH |
Write a review
Ask a question
My Review for SHLP3 (Small humanin-like peptide 3)
Required fields are marked with *
×
Ask a Question for SHLP3 (Small humanin-like peptide 3)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
