SHLP3 (Small humanin-like peptide 3)

Recent advances in high-resolution sequencing have led to the discovery of unique peptides derived from mitochondrial genome. 1-2 Currently 8 peptides are identified: humanin, mitochondrial open reading frame of the 12S tRNA-c (MOTS-c), and six small humanin-like peptides (SHLP1-6). 1-2 All of these peptides are released into cytosol from mitochondria. SHLP3 shares protective effects with Humanin, such as eduction in apoptosis, generation of reactive oxygen species and improving mitochondrial metabolism. In addition, it may participate in age-related disease pathology. 1-2

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: X21190

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
4380.4
Sequence
One Letter Code: H-MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW-OH
Three Letter Code: NH2-Met-Leu-Gly-Tyr-Asn-Phe-Ser-Ser-Phe-Pro-Cys-Gly-Thr-Ile-Ser-Ile-Ala-Pro-Gly-Phe-Asn-Phe-Tyr-Arg-Leu-Tyr-Phe-Ile-Trp-Val-Asn-Gly-Leu-Ala-Lys-Val-Val-Trp-COOH
References
1. Cobb L. J. et al., AGING 8 (4), 796-808 (2016).
2. Okada A. K. et al., Sci Reports 7 (7802), 1-10 (2017). .

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Peptide Nucleic Acids SynthesisCustom Conjugation ServicecGMP Peptide ServicePeptide CDMOPeptide Synthesis ServicesPeptide Modification ServicesPeptide Analysis ServicesEpitope Mapping Services
Hot Products
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers