Recent advances in high-resolution sequencing have led to the discovery of unique peptides derived from mitochondrial genome. 1-2 Currently 8 peptides are identified: humanin, mitochondrial open reading frame of the 12S tRNA-c (MOTS-c), and six small humanin-like peptides (SHLP1-6). 1-2 All of these peptides are released into cytosol from mitochondria. SHLP3 shares protective effects with Humanin, such as eduction in apoptosis, generation of reactive oxygen species and improving mitochondrial metabolism. In addition, it may participate in age-related disease pathology. 1-2
Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4380.4 |
Sequence | One Letter Code: H-MLGYNFSSFPCGTISIAPGFNFYRLYFIWVNGLAKVVW-OH Three Letter Code: NH2-Met-Leu-Gly-Tyr-Asn-Phe-Ser-Ser-Phe-Pro-Cys-Gly-Thr-Ile-Ser-Ile-Ala-Pro-Gly-Phe-Asn-Phe-Tyr-Arg-Leu-Tyr-Phe-Ile-Trp-Val-Asn-Gly-Leu-Ala-Lys-Val-Val-Trp-COOH |
References | 1. Cobb L. J. et al., AGING 8 (4), 796-808 (2016). 2. Okada A. K. et al., Sci Reports 7 (7802), 1-10 (2017). . |
3. Cell-based adhesion assays for isolation of snake venom’s integrin antagonists
4. Urinary Metabolites Associated with Blood Pressure on a Low-or High-Sodium Die
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com