Home > Product > Antimicrobial Peptides > Sperm associated antigen 11 isoform B

Antimicrobial Peptides

Sperm associated antigen 11 isoform B

Price Inquiry
CAT#
AF2162
Sequence
VHISHQEARGPSFKICVGFLGPRWARGCSTGN
Host Chemicals
Pan troglodytes
Length
32
Activity
Antimicrobial
SwissProt ID
Q9MZ28

Online Inquiry

Name (First Last) *
Email *
Phone *
Service & Products of Interest *
Quantities
Purity
Services Required and Project Description
Verification code *Please enter the code "peptides"
Home | Site Map | Contact Us | Resources
Copyright © 2008 - Creative Peptides. All rights reserved.