Keywords Search Google Search Search

Sperm associated antigen 11 isoform B

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2162
Sequence	VHISHQEARGPSFKICVGFLGPRWARGCSTGN
Activity	Antimicrobial

CAT#	Product Name	Inquiry
AF546	Alyteserin-2b	Inquiry
AF2944	CBD-1	Inquiry
AF1751	Proenkephalin A precursor	Inquiry
AF2378	Lingual antimicrobial peptide	Inquiry
AF3066	ETD133	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of dynorphin (1-17) in analgesia

In 1979, GOLDSTEIN et al. extracted an opioid-active 17 peptide from the pituitary of pigs and named it dynorphi ...

The therapeutic function of DAPTA

DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...

What is TB 500?

Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...

The Usage of Pentapeptide-31

of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...

Function of fertirelin acetate in prostate cancer and other diseases

Fertirelin acetate, classified into peptide hormone, is a gonadotropin-releasing hormone (GnRH) antagonist or ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Pan troglodytes
Length	32
SwissProt ID	Q9MZ28