CAT# | AF3246 |
Sequence | IFNSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPST |
Activity | Gram+ & Gram-, |
Host Chemicals | Strongylocentrotus purpuratus | Length | 48 |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
AF540 | Uperin 3.6 | Inquiry | ||
AF2743 | Tracheal antimicrobial peptide precursor | Inquiry | ||
AF1391 | Ocellatin-K1 | Inquiry | ||
AF334 | Mastoparan-A | Inquiry | ||
AF627 | Shuchin 1 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Proteolytic Processing of APP Following discovery of the full-length APP cDNA clone, numerous studies were undertaken to dete ...
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Figure 1. The structural formula of montirelinMontirelin, an analog of thyrotrophin-releasing hormone (TRH) is m ...
PBP 10 (RhoB-Glu-Arg-Leu-Phe-Glc-Val-Lys-Glc-Arg-Arg) is a 10-aa-long rhodamine-linked and membrane-permeable pe ...
Gonadorelin acetate, a synthetic decapeptide with sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2, is a gon ...