CAT# | H20003 |
Sequence | DSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF |
Length | 43 | Modifications | Phosphoserine(2,3) |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
X08666 | PM_1722891 | Inquiry | ||
X10152 | PM_19551865 | Inquiry | ||
X19644 | UP_P81780 | Inquiry | ||
X06883 | PM_15256578 | Inquiry | ||
X17409 | SLVRN_SW480 | Inquiry |
CAT# | Product Name | M.W | Molecular Formula | Inquiry |
---|---|---|---|---|
10-101-20 | Goserelin Acetate | 1269.43 | C59H84N18O14 | Inquiry |
10-101-59 | Liraglutide | 3751.2 | C172H265N43O51 | Inquiry |
R1574 | Octreotide | 1019.24 | C₄₉H₆₆N₁₀O₁₀S₂ | Inquiry |
10-101-139 | Myrcludex B | Inquiry | ||
10-101-285 | Teduglutide | 3752.08 | C164H252N44O55S | Inquiry |
R1847 | Sermaglutide | 4114 | C187H291N45O59 | Inquiry |
R1961 | Carbetocin | 988.2 | C45H69N11O12S | Inquiry |
Required fields are marked with *
×Required fields are marked with *
×* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Glucagon is a 29-amino acid peptide hormone that is synthesized in pancreatic α cells from the proglucagon precursor by proho ...
Sincalide is a brain and intestinal skin with a variety of physiological effects. It is widely distributed in th ...
An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...
Mambalgin 1, a toxin isolated from black mamba venom, is a disulfide-rich polypeptide consisting of 57 amino aci ...